Protein Info for PS417_11305 in Pseudomonas simiae WCS417

Annotation: general secretion pathway protein GspF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 403 transmembrane" amino acids 168 to 191 (24 residues), see Phobius details amino acids 219 to 240 (22 residues), see Phobius details amino acids 261 to 284 (24 residues), see Phobius details amino acids 374 to 396 (23 residues), see Phobius details PF28597: T2SSF_N" amino acids 1 to 40 (40 residues), 41.9 bits, see alignment 7.2e-15 TIGR02120: type II secretion system protein F" amino acids 4 to 402 (399 residues), 531.2 bits, see alignment E=1e-163 PF00482: T2SSF" amino acids 70 to 192 (123 residues), 112.5 bits, see alignment E=1.4e-36 amino acids 272 to 394 (123 residues), 103 bits, see alignment E=1.1e-33

Best Hits

Swiss-Prot: 45% identical to GSPF_PECCC: Type II secretion system protein F (outF) from Pectobacterium carotovorum subsp. carotovorum

KEGG orthology group: K02455, general secretion pathway protein F (inferred from 97% identity to pfs:PFLU2425)

Predicted SEED Role

"General secretion pathway protein F"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UAR3 at UniProt or InterPro

Protein Sequence (403 amino acids)

>PS417_11305 general secretion pathway protein GspF (Pseudomonas simiae WCS417)
MNRYRYEAADANGNVEAGHVEADSQSAAFANLRSRGLTALLVQIEGNQQAAAGSSLFTAK
LSDNDLAWATRQLASLLGASLPLEAALSATVEQAEKKHIAQTLSAVRADVRGGMRLADAL
AARPRDFPSIYRALIAAGEESGDLAQVMERLADYIEERNNLRGKILTAFIYPGVVGLVSI
GIVIFLLSYVVPQVVSAFSQARQDLPGLTLAMLNASDFVRAWGGLCFAGMVGGFWSWRLY
LRNPVARLSWHSRVLRLPLIGRFVLGLNTARFASTLAILGGAGVPLLRALEAARQTLSND
RLSQCVNDATAKVREGVNLAPALAVEKVFPPVLIHLIASGEKTGALPPMLERAAQTLSRD
IERRAMGMTALLEPLMIVVMGAVVLVIVMAVLLPIIEINQLVT