Protein Info for PS417_11295 in Pseudomonas simiae WCS417

Annotation: general secretion pathway protein GspD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 764 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details PF21305: type_II_gspD_N0" amino acids 92 to 161 (70 residues), 84.3 bits, see alignment E=6.6e-28 TIGR02517: type II secretion system protein D" amino acids 92 to 712 (621 residues), 683.3 bits, see alignment E=1.5e-209 PF03958: Secretin_N" amino acids 184 to 244 (61 residues), 51 bits, see alignment 2.1e-17 amino acids 247 to 315 (69 residues), 46.5 bits, see alignment E=5.4e-16 amino acids 321 to 451 (131 residues), 45.8 bits, see alignment E=8.7e-16 PF00263: Secretin" amino acids 537 to 703 (167 residues), 169 bits, see alignment E=1.1e-53

Best Hits

KEGG orthology group: K02453, general secretion pathway protein D (inferred from 95% identity to pfs:PFLU2423)

Predicted SEED Role

"General secretion pathway protein D"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UJX3 at UniProt or InterPro

Protein Sequence (764 amino acids)

>PS417_11295 general secretion pathway protein GspD (Pseudomonas simiae WCS417)
MKWSVPPFRMVAPLLVLALSACSNPSTAPLLVDSELGQPLADTRRSGETVLDRQSEPAPK
PPVQHRVTNSARGHAPAVVKARNPLGDQPVQLNFVDADIQAVVRALSRATGQQFLVDPRV
KGNLTLVSEGQVPAHQAYDMLLAALRMQGFSVVDVGGVAQVVPEADAKLLGGPIYTAGSS
GMQTRTFRLQYENAVNLIPVLRPIVSPNNPINAYPGNNSIVITDYAENLARVAQIINGID
TPSAIDTDVVRVQNGIAVDIAAMVSELLETQGADQTQKINVIGDPRSNSIIIRSGSPERT
ELARNLIYKLDNAQSNPSNMHVVYLRNAQAGKLAQSLRGLLTGESDSGVSDDARGKLSAM
GGNGKNTEGTSNAQNSSGTPTGSGVQSGYGQSTGSTTGTSGTSQDQDTSFSAGGVTIQAD
ATTNTLLISAPDPLYRNLREVIDMLDQRRAQVVIESLIVEVGEDDATEFGVQWQAGNLGG
KGGFGGVNLGGSGVNSTPTSKTSIDVLPKGLNVGLVDGTVDIPGIGKVLDLKVLARALKS
KGGTNVLSTPNLLTLDNEAASIFVGQTIPFVTGSYVTGGGGTSNNPFQTVQREEVGLKLN
VRPQISEGGTVKLDIYQEVSTVDERASVTAGTVTNKRAIDTSILLDDGQIMVLGGLLQDG
YSQSNDAVPWLSDIPGLGALFRNEKRSVSKTNLMVFLRPYIIRDSGAGRSITLNRYEFMR
RAQGGLQPEHSWAMPDVQAPQLPSVEKAIPGQQGPRAVIRAVPQ