Protein Info for GFF2210 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Hydrogenase transcriptional regulatory protein HoxA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 494 PF00072: Response_reg" amino acids 23 to 132 (110 residues), 78.9 bits, see alignment E=1e-25 PF00158: Sigma54_activat" amino acids 189 to 346 (158 residues), 224.8 bits, see alignment E=1.7e-70 PF14532: Sigma54_activ_2" amino acids 196 to 351 (156 residues), 66.7 bits, see alignment E=7.8e-22 PF07728: AAA_5" amino acids 204 to 322 (119 residues), 30.3 bits, see alignment E=1.2e-10 PF02954: HTH_8" amino acids 450 to 490 (41 residues), 46 bits, see alignment 1e-15

Best Hits

Swiss-Prot: 74% identical to HOXA_CUPNH: Hydrogenase transcriptional regulatory protein HoxA (hoxA) from Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)

KEGG orthology group: None (inferred from 80% identity to mpt:Mpe_A2808)

Predicted SEED Role

"Hydrogenase transcriptional regulatory protein HoxA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (494 amino acids)

>GFF2210 Hydrogenase transcriptional regulatory protein HoxA (Hydrogenophaga sp. GW460-11-11-14-LB1)
VDAAPSGLAPMNARFPADALPTVLVVDDEVRSQDAMRRTLDEDFTVFTASSADEARGLLE
RQPVSVILCDQRMPGMTGVSFLKEVRERWPDAVRMVISGYTDSEDIIAGINEAGIYQYIL
KPWAPDHLLDSVRNAVEAQALQRQTSRLDLELRTSTGVLRQRTATQIDRARASFGFDRLV
RAPGSPLDGVCAMAQRVARYDLSVLVLGESGTGKELLARAIHYASPRLTGPFVVENCAAI
PDTLLESELFGHKRGAFTGAYEDHPGLFQRAHGGTVFLDEIGETSPAFQVRLLRVLQEGE
VRPVGGARPVPVDVRVIAATHRDLEQRVREGLFREDLYYRLAGVSITVPPLRERAADIAP
IARQLLQDVAHELGHPGATLPDATLACLLAYPWPGNIRELRNEIARALALQDGSALEAAA
FSARVLQGHGNGGDDLQAALPTSGTLAERLDVIEAMVLRETLQRHRWNKTRVAQELGLSR
VGLRGKMQRLGLEK