Protein Info for PS417_01120 in Pseudomonas simiae WCS417

Annotation: choline transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 666 transmembrane" amino acids 18 to 37 (20 residues), see Phobius details amino acids 57 to 78 (22 residues), see Phobius details amino acids 94 to 114 (21 residues), see Phobius details amino acids 147 to 167 (21 residues), see Phobius details amino acids 191 to 213 (23 residues), see Phobius details amino acids 233 to 254 (22 residues), see Phobius details amino acids 264 to 283 (20 residues), see Phobius details amino acids 322 to 339 (18 residues), see Phobius details amino acids 351 to 370 (20 residues), see Phobius details amino acids 410 to 434 (25 residues), see Phobius details amino acids 454 to 473 (20 residues), see Phobius details amino acids 479 to 498 (20 residues), see Phobius details PF02028: BCCT" amino acids 17 to 505 (489 residues), 597.6 bits, see alignment E=7.9e-184 TIGR00842: transporter, betaine/carnitine/choline transporter (BCCT) family" amino acids 56 to 502 (447 residues), 511.4 bits, see alignment E=1e-157

Best Hits

Swiss-Prot: 46% identical to BETT_ECOLI: High-affinity choline transport protein (betT) from Escherichia coli (strain K12)

KEGG orthology group: K02168, high-affinity choline transport protein (inferred from 98% identity to pfs:PFLU0249)

MetaCyc: 46% identical to choline:H+ symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-99

Predicted SEED Role

"High-affinity choline uptake protein BetT" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U0S9 at UniProt or InterPro

Protein Sequence (666 amino acids)

>PS417_01120 choline transporter (Pseudomonas simiae WCS417)
MSASSTPSSGQVRMNAPVFYFAATFILLFGITVIAIPQQAGAWLLAAQNWAANTVGWYYM
LAMTLYLVFVVVTALSGYGKIKLGADHDEPEFSYLSWAGMLFAAGISITLFFFCVSEPLT
HLVQPPQGAPMNADAARQAMQILFLHWGLHGWGVFAFVGMALAYFAYRHNLPLALRSALY
PLIGKRINGPIGYAVDGFGIIATVFGLGADMGFGVLHLNSGLDYLFGIAHTQWIQVGLIT
LMMGAAIIVAVAGVDKGVRVMSDINMLLACALLLFVLFAGPTQHLLNTLIQNIGDYLGAL
PTKSFDVYAYDKPSDWLGGWTVFYWAWWIAWSPFVGLFIARISRGRTIREFVFGVLLIPL
GFTLAWMSIFGNSAIDQVLNHGLVALGQSAIDDPSMSLYLLLETYPWSKTVIAVTVFISF
VFFVTSADSGTVVLSTLSSKGGNADEDGPKWLRVFWGAMTALVTSALLFAGSIDSLKSAV
VLTSLPFSMILLLMMWGLHKAFYLESQKQIAQLHSLAPVSAARKGRGGWRQRLSQAVHFP
SRDEVYRFLESTVRPAIEEVTAVFVEKGLNVVTQPDPSNDSVSLEIGHGEERPFVYQVQM
RGYFTPSFARGGMGSKEINNRRYYRAEVHLAEGSQDYDLVGYTKEQIINDILDQYERHLQ
FLHLVR