Protein Info for PS417_11255 in Pseudomonas simiae WCS417

Annotation: general secretion pathway protein GspJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 203 transmembrane" amino acids 7 to 29 (23 residues), see Phobius details PF07963: N_methyl" amino acids 4 to 27 (24 residues), 36.1 bits, see alignment (E = 3.2e-13) TIGR02532: prepilin-type N-terminal cleavage/methylation domain" amino acids 5 to 27 (23 residues), 29.2 bits, see alignment (E = 2.8e-11) PF11612: T2SSJ" amino acids 72 to 193 (122 residues), 37.9 bits, see alignment E=2.2e-13

Best Hits

KEGG orthology group: K02459, general secretion pathway protein J (inferred from 90% identity to pfs:PFLU2415)

Predicted SEED Role

"General secretion pathway protein J"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UAQ4 at UniProt or InterPro

Protein Sequence (203 amino acids)

>PS417_11255 general secretion pathway protein GspJ (Pseudomonas simiae WCS417)
MNQSQQGFTLIEVMVAIMLMALVSLIAWRGLDSVTRADQHLQASTEQTEVLLRALNQMQR
DISLRASVELTLPSAPEDGAAKTEGLAAVTVRSSDSKGFRLDVIRSAPVAGDGLQRVRWW
LKGDSLYRAAAPARDRFPLPAAKDGVVVLTGVSDLQVRVWEADKGWRQLSGNRREDPLGL
EISLVRQTPQGVERYRQVVGPLN