Protein Info for GFF2206 in Variovorax sp. SCN45

Annotation: Type II/IV secretion system protein TadC, associated with Flp pilus assembly

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 320 transmembrane" amino acids 6 to 29 (24 residues), see Phobius details amino acids 108 to 129 (22 residues), see Phobius details amino acids 136 to 157 (22 residues), see Phobius details amino acids 287 to 313 (27 residues), see Phobius details PF00482: T2SSF" amino acids 175 to 302 (128 residues), 45.8 bits, see alignment E=3e-16

Best Hits

KEGG orthology group: K12511, tight adherence protein C (inferred from 74% identity to vpe:Varpa_5155)

Predicted SEED Role

"Type II/IV secretion system protein TadC, associated with Flp pilus assembly" in subsystem Widespread colonization island

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (320 amino acids)

>GFF2206 Type II/IV secretion system protein TadC, associated with Flp pilus assembly (Variovorax sp. SCN45)
MTFTSNQLAIFSIALLALGLMVGAGALIAAERRRTRSGQVIGRAIRQAALTPGSQSATVA
EVEAENAFKPELELPFHWLDSRLGRAFVADEDRNLIDQCGLPSKRTQLIFLVTRISLAFV
FPLLAYLLWSSGHEQGTVVTVLAACAVLGFMAPKWVLGRFAAGRRERASRELPLFIDLLR
LLQGVGLSLDQSLQIMATDFSHVLHVLGYELGIANAQYSQGRTREHSLHRLATLHKNENL
RGLVSLLVQVDRHGGAVQEPLRVFSDRLRESRRSEMKERIGKITVKMTGVMVVSLLPALV
IITAGPGFIAIFHSLGAIGK