Protein Info for PS417_11240 in Pseudomonas simiae WCS417

Annotation: VreA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 214 signal peptide" amino acids 1 to 14 (14 residues), see Phobius details PF07660: STN" amino acids 41 to 90 (50 residues), 34.5 bits, see alignment E=1.4e-12 PF13103: TonB_2" amino acids 113 to 184 (72 residues), 35.6 bits, see alignment E=8.3e-13 TIGR01352: TonB family C-terminal domain" amino acids 138 to 191 (54 residues), 29.3 bits, see alignment E=4.4e-11

Best Hits

KEGG orthology group: None (inferred from 88% identity to pfs:PFLU2412)

Predicted SEED Role

"Outer membrane TonB-dependent transducer VreA of trans-envelope signaling system"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See U1S691 at UniProt or InterPro

Protein Sequence (214 amino acids)

>PS417_11240 VreA (Pseudomonas simiae WCS417)
MLLLLAGGRPAQAESPLLSLNLPAQDLEHALQAYSRATGMAVLVDRELTRGRRSIGVRGR
FTAQEALAMLLTGSGLMARYARSDAFTLQAPQVSPPTTSRGAAARSAARINNSYASALQQ
AIETSLCRSPLTRPGSFRALVQVWVNPDGVIEHSRLVSSSGDEQRDEALVRSLSAARVER
PAPSSLRQPVTLLLMPDTTGTRMECTAAKGAWGG