Protein Info for GFF22 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Methionine ABC transporter permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 212 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 47 to 70 (24 residues), see Phobius details amino acids 76 to 100 (25 residues), see Phobius details amino acids 140 to 161 (22 residues), see Phobius details amino acids 177 to 198 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 26 to 209 (184 residues), 76.3 bits, see alignment E=1.4e-25

Best Hits

Swiss-Prot: 100% identical to METI_SALTY: D-methionine transport system permease protein MetI (metI) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K02072, D-methionine transport system permease protein (inferred from 99% identity to ses:SARI_02755)

MetaCyc: 93% identical to L-methionine/D-methionine ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
RXN0-4522 [EC: 7.4.2.11]; 7.4.2.11 [EC: 7.4.2.11]; TRANS-RXN-383 [EC: 7.4.2.11]; TRANS-RXN0-510 [EC: 7.4.2.11]; TRANS-RXN0-511 [EC: 7.4.2.11]

Predicted SEED Role

"Methionine ABC transporter permease protein" in subsystem Methionine Biosynthesis or Methionine Degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (212 amino acids)

>GFF22 Methionine ABC transporter permease protein (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MWLLVRGVWETLAMTFVSGFFGFVIGLPVGVLLYVTRPGQIMENARLYRSLSAVVNIFRS
IPFIILLVWMIPFTRIIVGTSIGLQAAIVPLTVGAAPFIARMVENALLEIPAGLIEASRA
MGATPLQIVRKILLPEALPGLVNAATITLITLVGYSAMGGAVGAGGLGQIGYQYGYIGYN
ATVMNTVLVLLVVLVYLIQLSGDRIVRAVTHK