Protein Info for GFF2198 in Variovorax sp. SCN45

Annotation: Type I secretion membrane fusion protein, HlyD family @ Type I secretion system, membrane fusion protein LapC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 438 transmembrane" amino acids 29 to 49 (21 residues), see Phobius details TIGR01843: type I secretion membrane fusion protein, HlyD family" amino acids 25 to 437 (413 residues), 326.4 bits, see alignment E=1.4e-101 PF13533: Biotin_lipoyl_2" amino acids 71 to 95 (25 residues), 25.9 bits, see alignment (E = 1.3e-09) PF16576: HlyD_D23" amino acids 210 to 372 (163 residues), 33.7 bits, see alignment E=4.7e-12 PF13437: HlyD_3" amino acids 288 to 391 (104 residues), 52 bits, see alignment E=2.1e-17

Best Hits

KEGG orthology group: K02022, (no description) (inferred from 92% identity to vpe:Varpa_5163)

Predicted SEED Role

"HlyD family secretion protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (438 amino acids)

>GFF2198 Type I secretion membrane fusion protein, HlyD family @ Type I secretion system, membrane fusion protein LapC (Variovorax sp. SCN45)
LKSDLPQILQDEQDKRAAQTSPQGRRRQWIIGGAVAVLALVGLGFPMETVVVAPGRVIPS
DRVKSIQHLEGGIVSSVLVKEGDKVKTGQPLVEIDLGGSGLNLEELTARYAATQATRVRL
MAESRGQPLRRESFAKDIDEGVFEGETGAYQARALEQRGVMAGAVSGLEQARSKKLEQQA
KVKGLGDRLELMQKELEISEQLLSEKLVGQVEVLEKRRQAESVRSELAVARQGVVSADAA
ITEAQAKMAEAEGRYRRRASDELATVERQFASLSEDLARARTQRSRTVVKAPSDGIVKGL
RNSSPGWVVKPGESILEVVPDEDEIMVEARLNPNDRGFIEVGQTARVKITAYDYLRYGAV
DGKVKLVAADADRDPAISNGAPYYRLLISMSQSHVGRDENRITAGMESEVDLRVGTDPFI
WYILRPVLKLRREAFREP