Protein Info for GFF2196 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Hypothetical protein CbbY

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 256 PF00702: Hydrolase" amino acids 3 to 193 (191 residues), 96.4 bits, see alignment E=4.5e-31 PF13419: HAD_2" amino acids 5 to 197 (193 residues), 76.4 bits, see alignment E=4.8e-25 TIGR01509: HAD hydrolase, family IA, variant 3" amino acids 79 to 197 (119 residues), 51.4 bits, see alignment E=1.4e-17 PF13242: Hydrolase_like" amino acids 155 to 206 (52 residues), 23.7 bits, see alignment E=5.5e-09

Best Hits

Swiss-Prot: 62% identical to CBBYC_CUPNH: Protein CbbY, chromosomal (cbbYC) from Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)

KEGG orthology group: None (inferred from 63% identity to cti:RALTA_B1698)

Predicted SEED Role

"Hypothetical protein CbbY"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (256 amino acids)

>GFF2196 Hypothetical protein CbbY (Hydrogenophaga sp. GW460-11-11-14-LB1)
MLEALIFDVDGTLADTEAAHRAAFNDAFAEVRLDWHWDDATYIRLLQVSGGKERIAHHWR
MVEPDVAGGKAAQATIERVHAIKTRLYESRVSGGQLALRPGVLRLMREALASGLRLAIAT
TTTPANIDALLRTPLGPDWKRHFAAIGDAATAPRKKPDPQVYQQVLATLGLPASACLAFE
DSANGLRAATAAGLQTLVTPTVHTADHRFDDALLVLPHLGDVNQLLPSGVAGMEQRWVTV
DALRRWHAGTTLFESA