Protein Info for GFF2195 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: probable RuBisCo-expression protein CbbX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 323 TIGR02880: CbbX protein" amino acids 38 to 314 (277 residues), 510 bits, see alignment E=8.1e-158 PF07728: AAA_5" amino acids 90 to 160 (71 residues), 24.9 bits, see alignment E=2.6e-09 PF00004: AAA" amino acids 91 to 223 (133 residues), 63.1 bits, see alignment E=5.8e-21 PF17866: AAA_lid_6" amino acids 227 to 309 (83 residues), 78.9 bits, see alignment E=4.3e-26

Best Hits

Swiss-Prot: 69% identical to CBXXC_CUPNH: Protein CbxX, chromosomal (cbxXC) from Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)

KEGG orthology group: None (inferred from 73% identity to mpt:Mpe_A1480)

Predicted SEED Role

"probable RuBisCo-expression protein CbbX" in subsystem CO2 uptake, carboxysome

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (323 amino acids)

>GFF2195 probable RuBisCo-expression protein CbbX (Hydrogenophaga sp. GW460-11-11-14-LB1)
MSYLIPGSTPPPLSTDATVTTAAAPVATPPARSVGAVLADTQVEAVLQELDDELVGLAPV
KARVRDIAALLVIDKLRTGLGLPSQPPSLHMCFSGNPGTGKTTVALRMAQILHRLGYVRK
GHLVAVTRDDLVGQYIGHTAPKTREVLKKAMGGVLFIDEAYYLYRPENERDYGQEAIEIL
LQVMENHRDDLVVILAGYEDRMNTFFQSNPGMRSRIAHHLTFPDYSAGELMQISRQMLAE
QNYRFSPEAAEAFERYLGLRLQQPHFANARSVRNALDRARLRQASRLFAQPQRELTAEEL
TTLQAPDILASRLFSDAEGAGHA