Protein Info for PS417_11175 in Pseudomonas simiae WCS417

Annotation: AraC family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 312 PF01965: DJ-1_PfpI" amino acids 28 to 167 (140 residues), 56.9 bits, see alignment E=3.5e-19 PF00165: HTH_AraC" amino acids 216 to 252 (37 residues), 37.7 bits, see alignment 2.6e-13 PF12833: HTH_18" amino acids 228 to 306 (79 residues), 69.3 bits, see alignment E=4.4e-23

Best Hits

KEGG orthology group: None (inferred from 99% identity to pfs:PFLU2396)

Predicted SEED Role

"Transcriptional regulator containing an amidase domain and an AraC-type DNA-binding HTH domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TYJ5 at UniProt or InterPro

Protein Sequence (312 amino acids)

>PS417_11175 AraC family transcriptional regulator (Pseudomonas simiae WCS417)
MHSVALMVYPNFQSLSLSLGSVFECANLLRGEPAYEFHLVSESGGAVMTSQGFSVNTTPI
RPEGYDTLIVSGYLEFRLPEANLLELVKAASAQSRRVASLCMGIFVLAEAGLLEGKRTTT
HWIHAPAFRKRYPDIRLEEDKLFIVDGHVWTGAGMSAGVDLALAMVENDLGSDLARRIAR
KLVIAQRRGSEQSQLSALLELDPKSDRVQLALAYARENLTHDLSVEALADVARLSPRQFS
RVFREETGQTPAKAIESLRVEAARAMMETSRHPVEVVARETGFGDRERMRQAFLRAFGQP
PQVMQQALFIPG