Protein Info for GFF2191 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Beta-lactamase class C and other penicillin binding proteins

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 432 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF00144: Beta-lactamase" amino acids 45 to 408 (364 residues), 207.9 bits, see alignment E=1.2e-65

Best Hits

Swiss-Prot: 100% identical to YFEW_SALTY: Putative D-alanyl-D-alanine carboxypeptidase (yfeW) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: None (inferred from 99% identity to seg:SG2508)

MetaCyc: 73% identical to penicillin binding protein 4B (Escherichia coli K-12 substr. MG1655)
Serine-type D-Ala-D-Ala carboxypeptidase. [EC: 3.4.16.4]

Predicted SEED Role

"Beta-lactamase class C and other penicillin binding proteins" in subsystem Beta-lactamase

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.4.16.4

Use Curated BLAST to search for 3.4.16.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (432 amino acids)

>GFF2191 Beta-lactamase class C and other penicillin binding proteins (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MKFTLVATVLLTFSLSAFAVEYPVLTTASPDQVGFDSQKLHRLDGWIQNQIDAGYPSINL
LVIKDNHIVLQKAWGYAKKYDGSTLLAHPIRATTNTMYDLASNTKMYATNFALQKLVYEG
KIDVNDLVSKYIPGFKDMPGDKIKGKNKLRIIDILHHVAGFPADPQYPNKNVAGKLFSQS
KSTTLEMIKKTPLEYQPGSKHIYSDVDYMILGFIIESITAMPLDRYVETTIYKPLGLKHT
VFNPLMKGFTPPQIAATELHGNTRDGVIHFPNIRTNTLWGQVHDEKAWYSMGGVSGHAGL
FSDTHDMAVLMQVMLNGGGYGNVKLFDDKTVAQFTRRSPEDATFGLGWRVNGNASMTPTF
GVLASPQTYGHTGWTGTLTSIDPVNHMAIVILGNRPHSPVANPKVNPNVFVSGLLPAATY
GWIVDQIYGSLK