Protein Info for GFF2183 in Variovorax sp. SCN45

Annotation: Outer membrane component of TAM transport system

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 645 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 26 to 27 (2 residues), see Phobius details PF01103: Omp85" amino acids 434 to 645 (212 residues), 86.8 bits, see alignment E=3.3e-28

Best Hits

KEGG orthology group: None (inferred from 88% identity to vpe:Varpa_5178)

Predicted SEED Role

"Uncharacterized protein YtfM precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (645 amino acids)

>GFF2183 Outer membrane component of TAM transport system (Variovorax sp. SCN45)
MVRVVPVSLPAWWPALLFSGVLLLQGCSLLPKKDASEGKPVAGLVRGDSTADTTKDNRNS
DDKKDKADKRDAFTVDVRGPEAVRDYLKLHLEIQRYRELDDLGATEISRLMVAAEANARE
LLGTLGYFTPTLTLELNETPQGAKAPREIVITVSPGELTKVSNVQISYGGPIADDATAEA
QRDSIRTAWALRAGQPFTQQAWDEAKTTALRSLTAKRFPTGNIEISRAEVDADRHEARLS
VTYQSGPAYKFGPLVLRGIQRYDPDGARRIARLPSGQDYDQQKLLDAQQRLASSGYYDSV
FLTLDTESGNPLAAPVIAQLREAPLQKVVLGAGFTTDNGPRLSVDHIHNQVPLLGWRAVS
RLSVDRDIKSLSTELNAIPDDHGWRWFSGAELKSEQSGSYVVDSGRLRGGRNKSSDHIDR
SYFLQYDYAQNRGTNAPPSASAVTANWGWTGRYFDNNSAPSRGFGIALEVAAGYTLTGMQ
TPFTRTYARWLGVLPLGSSDDKETNARRSRLQLRLEGGAVAAKDSAQIPSTLMFLTGGDT
TVRGYSYKQIGTVRPDGTTVAGRYLGVASVEWQRPVVYNNKLTDWESVVFVDAGAVADKP
AELKPKVGVGVGARWRSPVGPVQADLAYGVDSKRFRLHFRLGFTF