Protein Info for GFF2182 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Phosphoribosylaminoimidazole-succinocarboxamide synthase (EC 6.3.2.6)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00081: phosphoribosylaminoimidazolesuccinocarboxamide synthase
  • amino acids 3 to 235 (233 residues), 281 bits, E=5.5e-88
• PF01259: SAICAR_synt
  • amino acids 7 to 231 (225 residues), 262 bits, E=2.8e-82

Best Hits

Swiss-Prot: 100% identical to PUR7_SALPK: Phosphoribosylaminoimidazole-succinocarboxamide synthase (purC) from Salmonella paratyphi A (strain AKU_12601)

KEGG orthology group: K01923, phosphoribosylaminoimidazole-succinocarboxamide synthase [EC: 6.3.2.6] (inferred from 100% identity to seg:SG2517)

MetaCyc: 95% identical to phosphoribosylaminoimidazole-succinocarboxamide synthase (Escherichia coli K-12 substr. MG1655)
Phosphoribosylaminoimidazolesuccinocarboxamide synthase. [EC: 6.3.2.6]

Predicted SEED Role

"Phosphoribosylaminoimidazole-succinocarboxamide synthase (EC 6.3.2.6)" in subsystem De Novo Purine Biosynthesis (EC 6.3.2.6)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (46/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (26/26 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• inosine-5'-phosphate biosynthesis I (6/6 steps found)
• inosine-5'-phosphate biosynthesis II (5/5 steps found)
• inosine-5'-phosphate biosynthesis III (5/6 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.6

Protein Sequence (237 amino acids)

>GFF2182 Phosphoribosylaminoimidazole-succinocarboxamide synthase (EC 6.3.2.6) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MQKQAELYRGKAKTVYSTENPDLLVLEFRNDTSAGDGARIEQFDRKGMVNNKFNHFIMTK
LAEAGIPTQMERLLSDTECLVKKLEMVPVECVVRNRAAGSLVKRLGVEEGMELNPPIFDL
FLKNDALHDPMVNSSYCETFGWVSQENLARMKELTYKANDVLKKLFDDAGLILVDFKLEF
GLYKGEVVLGDEFSPDGSRLWDKETLDKMDKDRFRQSLGGLIEAYEAVAHRLGVKLD