Protein Info for PS417_11120 in Pseudomonas simiae WCS417

Annotation: UDP pyrophosphate phosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 289 transmembrane" amino acids 18 to 36 (19 residues), see Phobius details amino acids 56 to 75 (20 residues), see Phobius details amino acids 98 to 120 (23 residues), see Phobius details amino acids 131 to 152 (22 residues), see Phobius details amino acids 168 to 194 (27 residues), see Phobius details amino acids 204 to 227 (24 residues), see Phobius details amino acids 238 to 258 (21 residues), see Phobius details amino acids 269 to 288 (20 residues), see Phobius details PF02673: BacA" amino acids 22 to 279 (258 residues), 252.4 bits, see alignment E=2.9e-79 TIGR00753: undecaprenyl-diphosphatase UppP" amino acids 22 to 277 (256 residues), 229.6 bits, see alignment E=2.5e-72

Best Hits

Swiss-Prot: 73% identical to UPPP2_RHILO: Undecaprenyl-diphosphatase 2 (uppP2) from Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)

KEGG orthology group: K06153, undecaprenyl-diphosphatase [EC: 3.6.1.27] (inferred from 99% identity to pfs:PFLU2394)

Predicted SEED Role

"Undecaprenyl-diphosphatase (EC 3.6.1.27)" (EC 3.6.1.27)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.27

Use Curated BLAST to search for 3.6.1.27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U8D3 at UniProt or InterPro

Protein Sequence (289 amino acids)

>PS417_11120 UDP pyrophosphate phosphatase (Pseudomonas simiae WCS417)
MSNVCSAGLDVGFASLDYLQIFILGVIQGITELLPVSSTAHMRVVPALLGWQDPGSAFSA
AMQLAALAAVVSYFWRDVRQVTTGSIGAVRRGDYNDRWFKLAVAIVLATIPIGIAGLVLS
STLNACNSPLRGLMVIGISCVVMAVLLAVAEVRARHTREVSEMRLRDALIVGIAQIGALI
PGVSRSGSTLTAALFLNFKREEAARFSFLLGLPAIALAGLKELWVLLHADMPAHAWPHLL
FGLVVASISAFFAIWGLMKFLERFSTWPFVIYRALLGIFLIVAVSTGLL