Protein Info for GFF2179 in Xanthobacter sp. DMC5

Annotation: Phthiocerol synthesis polyketide synthase type I PpsC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 328 TIGR02824: putative NAD(P)H quinone oxidoreductase, PIG3 family" amino acids 1 to 326 (326 residues), 337.7 bits, see alignment E=3.2e-105 PF08240: ADH_N" amino acids 27 to 110 (84 residues), 59 bits, see alignment E=7.6e-20 PF00107: ADH_zinc_N" amino acids 152 to 280 (129 residues), 99.3 bits, see alignment E=2.5e-32 PF13602: ADH_zinc_N_2" amino acids 183 to 324 (142 residues), 96.1 bits, see alignment E=5e-31

Best Hits

KEGG orthology group: None (inferred from 84% identity to sno:Snov_2924)

Predicted SEED Role

"Quinone oxidoreductase (EC 1.6.5.5)" in subsystem ZZ gjo need homes (EC 1.6.5.5)

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.5

Use Curated BLAST to search for 1.6.5.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (328 amino acids)

>GFF2179 Phthiocerol synthesis polyketide synthase type I PpsC (Xanthobacter sp. DMC5)
MKAIVFDAFGPADVLHLGDVSMPEVRPGDLLVKVHAAGVNRADLLQRQGYYGRQSYGESD
LLGLEVAGEVVAVGGDVADVRIGERVMAIVGGGAYAEYARVDRGMAVRIPPGLDALGAAA
VMESFVTAWEAAVHLGGTAKDTSILVHAAAGGVGSAVVKIAHALGAHVFATSNAERRDDV
LALGAEAVFDYRSEDFEKGVRDATGGTGVDVVVDFVGGDYLPRNLRSLAPGGRLVQVGLL
GGQDSTTIPLALLLHNHLRLIGTVMKSRTADEKRAMVRRFAEGALPLFADGRLTPLVGRV
YPLAQAAEAHRAMEEGGGFGKVVLKVVE