Protein Info for GFF2176 in Xanthobacter sp. DMC5

Annotation: L-lactate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 391 PF01070: FMN_dh" amino acids 13 to 375 (363 residues), 413.6 bits, see alignment E=3.2e-128

Best Hits

Swiss-Prot: 85% identical to LLDD_XANP2: L-lactate dehydrogenase (lldD) from Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)

KEGG orthology group: K00101, L-lactate dehydrogenase (cytochrome) [EC: 1.1.2.3] (inferred from 85% identity to xau:Xaut_3929)

MetaCyc: 76% identical to L-lactate dehydrogenase (Escherichia coli K-12 substr. MG1655)
1.1.5.M6 [EC: 1.1.5.M6]; RXN0-7227 [EC: 1.1.5.M6]

Predicted SEED Role

"L-lactate dehydrogenase (EC 1.1.2.3)" in subsystem L-rhamnose utilization or Lactate utilization or Respiratory dehydrogenases 1 (EC 1.1.2.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.2.3

Use Curated BLAST to search for 1.1.2.3 or 1.1.5.M6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (391 amino acids)

>GFF2176 L-lactate dehydrogenase (Xanthobacter sp. DMC5)
VIISSASDYREAARRRLPPFLFHYIDGGAYAEVTLGRNVSDLTQLALRQRVLKSVGDVDL
STTLLGEKLAMPMALAPVGLCGMFARRGEVQAAKAALDKGIQFTLSTVSVCPIEEVRAKV
EKPFWFQLYVLKDRGFMKNALERAWAAGIRTLVFTVDMPVPGARYRDAHSGMSGPNAAVR
RMVQAALHPFWAYDVGLMGTPHDLGNVSAYRGNKTTLEDYVGWLGANFDPSIGWRDLEWI
REFWKGPMVIKGILDPEDAEDAVRFGADGIVVSNHGGRQLDGVLSSARALPPIADKVKGS
LAILADSGIRSGLDVVRMVAQGADGVLLGRAFVYALATDGQKGVENLLDLFAKEMRVAMT
LTGARNLSEISSESLVREVEQPLKNISAAAE