Protein Info for GFF2176 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Putative permease PerM (= YfgO)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 352 transmembrane" amino acids 16 to 48 (33 residues), see Phobius details amino acids 69 to 90 (22 residues), see Phobius details amino acids 148 to 174 (27 residues), see Phobius details amino acids 214 to 235 (22 residues), see Phobius details amino acids 237 to 267 (31 residues), see Phobius details amino acids 278 to 298 (21 residues), see Phobius details amino acids 304 to 329 (26 residues), see Phobius details PF01594: AI-2E_transport" amino acids 17 to 342 (326 residues), 289.4 bits, see alignment E=1.9e-90

Best Hits

Swiss-Prot: 94% identical to PERM_ECO57: Putative permease PerM (perM) from Escherichia coli O157:H7

KEGG orthology group: K03548, putative permease (inferred from 100% identity to see:SNSL254_A2688)

Predicted SEED Role

"Putative permease PerM (= YfgO)" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (352 amino acids)

>GFF2176 Putative permease PerM (= YfgO) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MLMQWYRRRFSDPEAIALLVILVAGFSILFFFSGLLAPLLVAIVLAYLLEWPTARLQAIG
CSRRWAASIVLILFVGILLLMAFVVMPIAWQQGIYLIRDMPGMLNKLSDFAATLPRRYPA
LMDAGIIDAMAENMRTRMLNMGDSVVKYSLASLVGLLTLAVYLVLVPLMVFFLVKDKEQM
LNAVRRVLPRNRGLAGQVWNEMNQQITNYIRGKVLEMVVVGVATWLGFLLFGLNYSLLLA
VLVGFSVLIPYIGAFVVTIPVVGVALFQFGLGTEFWSCFAVYLIIQALDGNLLVPVLFSE
AVNLHPLVIILSVVIFGGLWGFWGVFFAIPLATLIKAVVHAWPDGQVTDASS