Protein Info for PS417_11095 in Pseudomonas simiae WCS417

Annotation: fatty acid desaturase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 364 transmembrane" amino acids 52 to 70 (19 residues), see Phobius details amino acids 74 to 95 (22 residues), see Phobius details amino acids 116 to 133 (18 residues), see Phobius details amino acids 160 to 179 (20 residues), see Phobius details amino acids 209 to 227 (19 residues), see Phobius details amino acids 232 to 256 (25 residues), see Phobius details PF00487: FA_desaturase" amino acids 78 to 320 (243 residues), 137.4 bits, see alignment E=3.7e-44

Best Hits

KEGG orthology group: None (inferred from 94% identity to pfs:PFLU2390)

Predicted SEED Role

"probable hydrocarbon oxygenase MocD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See U1TXG3 at UniProt or InterPro

Protein Sequence (364 amino acids)

>PS417_11095 fatty acid desaturase (Pseudomonas simiae WCS417)
MPEHTAPISRRDYSLTGPEAARAFDKGLVSASWYQSPISRKRMKELMQRRDGPALLDTAI
WVSALFATGFGGYWFWGTWACVPFFLAYGVLYGTASNPRWHETGHGTAFKTRWMNDVLYQ
VASFMCIFEPHVWRWSHARHHTDTIVVGRDPEIVEPRPPSFLMMFLSLFNLPLAWKTFSG
VARHAIGKMSAQEADFIPESEWPKVFRAARIWVGIYAVVIGTALYLHSWLPLMLVGLPSL
YGAWLGYLFGLTQHVGLAEDVLDHRSNCRTIYMNRVLRFIYMDMNYHLEHHMYPMVPYHA
LAQLHEEIRSDCPPPYANLFEAYKEILPTIWKQRSDPTYFIQRPLAHNPRGEGACSRWAA
QQPQ