Protein Info for GFF2174 in Xanthobacter sp. DMC5

Annotation: Colistin resistance protein EmrA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 416 transmembrane" amino acids 64 to 85 (22 residues), see Phobius details PF25917: BSH_RND" amino acids 106 to 299 (194 residues), 42.3 bits, see alignment E=1.1e-14 PF25876: HH_MFP_RND" amino acids 171 to 236 (66 residues), 35.9 bits, see alignment E=1.4e-12 PF25963: Beta-barrel_AAEA" amino acids 303 to 396 (94 residues), 27.8 bits, see alignment E=4.2e-10 PF25954: Beta-barrel_RND_2" amino acids 304 to 346 (43 residues), 25.7 bits, see alignment 2.1e-09

Best Hits

KEGG orthology group: K03543, multidrug resistance protein A (inferred from 73% identity to xau:Xaut_1512)

Predicted SEED Role

"Membrane fusion component of tripartite multidrug resistance system" in subsystem Multidrug Resistance, Tripartite Systems Found in Gram Negative Bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (416 amino acids)

>GFF2174 Colistin resistance protein EmrA (Xanthobacter sp. DMC5)
VAQIIKKEAAAPALAPQPQPDAQSETPSAGVTVLKARREETHPAAPAVEAQAPAPAKARS
RKPFIFGTVLAVLAVAGGWYGLNWWQVGRFQVSTDDAYVAADTSVIAAKVGGYVKSVDVD
TNQWVKAGDVIARIDDGDYRLALQSAENKIATQEATLSRFDQQETAARATVDQMKAQLAS
AEADQRRAQAEFDRQDKLARSDFASRSTLDNARADKDKTAASVEAAKAAIASAEAQVVVL
AAQRTEASHVLDELKTARDQAKRDLDFTVVRAPIDGVVGNRAAQVGQLVQTGTRLVAVVP
LESVYVDANFKETQLGRLKPGQSVNVYVDAYPDHDFAGKVVSVSPASGSVFSLLPPENAT
GNFTKIVQRIPVRIAIDPNVLAKHELRPGMSVTATVDTKSAPATSTAAAPTSSPAS