Protein Info for PS417_11090 in Pseudomonas simiae WCS417

Annotation: LacI family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 349 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 41 to 57 (17 residues), see Phobius details amino acids 69 to 89 (21 residues), see Phobius details PF00356: LacI" amino acids 8 to 50 (43 residues), 34.8 bits, see alignment 1.2e-12 PF13407: Peripla_BP_4" amino acids 70 to 323 (254 residues), 101.9 bits, see alignment E=4.5e-33

Best Hits

KEGG orthology group: K02529, LacI family transcriptional regulator (inferred from 92% identity to pfs:PFLU2389)

Predicted SEED Role

"Transcriptional regulator, LacI family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UE16 at UniProt or InterPro

Protein Sequence (349 amino acids)

>PS417_11090 LacI family transcriptional regulator (Pseudomonas simiae WCS417)
MNNKKRPTIATVAAHAGLSVATVDRVLNARAPVNPETAEQVFQAAEAVGYFAARLIGQRI
RERRPTYRFGILLLATAQAFYASLAHAISAAAEQHAGANLTCQFDYIVDRTPAAIVAQIE
QLAVQCDGLAVVSFAHPLINACLKQIREAGVPVVALLSDIHEQAEEPYVGQDNHVVGRTM
GWLLARTCGARKGSVGILLGGHRFLGHQARVEGLHSYLAEHAPGLKPLEPLINLDNCDIT
EEATLDLLSRHSDLRGLCVVGGGGDGIISALAQLPKRPALCCILQESTELSRHALRQGLI
DVVMDSQPGQTAIALVQLMVQLQSTEAFDPVQQRVYIPPQIVTSENMGH