Protein Info for GFF2174 in Methylophilus sp. DMC18

Annotation: Glutathione synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 311 TIGR01380: glutathione synthase" amino acids 1 to 309 (309 residues), 393.4 bits, see alignment E=3.1e-122 PF02951: GSH-S_N" amino acids 1 to 117 (117 residues), 133.5 bits, see alignment E=5.8e-43 PF02955: GSH-S_ATP" amino acids 121 to 294 (174 residues), 248.2 bits, see alignment E=5.1e-78 PF08443: RimK" amino acids 153 to 297 (145 residues), 44.4 bits, see alignment E=2.2e-15

Best Hits

Swiss-Prot: 53% identical to GSHB_RALSO: Glutathione synthetase (gshB) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K01920, glutathione synthase [EC: 6.3.2.3] (inferred from 70% identity to mmb:Mmol_2264)

Predicted SEED Role

"Glutathione synthetase (EC 6.3.2.3)" in subsystem Glutathione: Biosynthesis and gamma-glutamyl cycle or Heat shock dnaK gene cluster extended (EC 6.3.2.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (311 amino acids)

>GFF2174 Glutathione synthetase (Methylophilus sp. DMC18)
MKLLFILDPLASLKSYKDTSLAIMRAAQARGHVLWVCEQHDWHLQQAEVKVDAQTFAFNA
DGHWQTGDKITQAPASFDAVLMRKDPPFDNEYLYSTYLLELAQQQGARIINDPSSIRGWN
EKLSVARFPQFAPPFIVTSLQSKILAFLAEHQDIIVKPLDGMGGSGIFRLRQDDPNIYAI
LETLTRFEAQTIMVQRYIPEIVKGDKRILIINGEPLPYALARIPKTGETRGNLAAGGKGV
AQPLSARDKEIAETVGSVLKQHGLFLVGLDVIGDYLTEVNVTSPTGMVEIAAQTDCDPAR
VMVEALEKQMA