Protein Info for GFF2172 in Variovorax sp. SCN45

Annotation: Permease of the drug/metabolite transporter (DMT) superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 290 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details transmembrane" amino acids 27 to 46 (20 residues), see Phobius details amino acids 58 to 77 (20 residues), see Phobius details amino acids 88 to 107 (20 residues), see Phobius details amino acids 116 to 136 (21 residues), see Phobius details amino acids 142 to 162 (21 residues), see Phobius details amino acids 174 to 193 (20 residues), see Phobius details amino acids 206 to 227 (22 residues), see Phobius details amino acids 239 to 258 (20 residues), see Phobius details amino acids 264 to 281 (18 residues), see Phobius details PF00892: EamA" amino acids 1 to 130 (130 residues), 67.2 bits, see alignment E=9.7e-23 amino acids 143 to 279 (137 residues), 65.8 bits, see alignment E=2.6e-22

Best Hits

KEGG orthology group: None (inferred from 44% identity to bbr:BB0062)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (290 amino acids)

>GFF2172 Permease of the drug/metabolite transporter (DMT) superfamily (Variovorax sp. SCN45)
MLLAMVLWGVNVSAVKALTTSFESLPLASLRMVVACLALSAIVLWRRGGVPALGARQLAA
MTGCAFLMVYANQILFAQGLLRSTATNGALIMALSPLVSALMAALVFRERFTPRRMLGVA
LGFAGVAAVVLSHPGAGLSRAGIGDLMLALAVVSFAVGGVGVQRLARQIDPLSISWVIYM
IGTAMLVLHTLLGPSRLGTAELFPGAWPWALVLFSGIAATAAGNLIWNRAISVIGVARTA
VFLYWVPVFGVAFAALLLGEVLTWWHLFGFVAVMSGTWLGTRPAATTTAP