Protein Info for GFF2171 in Xanthobacter sp. DMC5

Annotation: Aldehyde oxidoreductase FAD-binding subunit PaoB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 316 PF00941: FAD_binding_5" amino acids 3 to 221 (219 residues), 151.9 bits, see alignment E=1.5e-48

Best Hits

Swiss-Prot: 74% identical to PAOB_ECOLI: Aldehyde oxidoreductase FAD-binding subunit PaoB (paoB) from Escherichia coli (strain K12)

KEGG orthology group: K11178, xanthine dehydrogenase YagS FAD-binding subunit [EC: 1.17.1.4] (inferred from 79% identity to ara:Arad_7432)

MetaCyc: 74% identical to aldehyde dehydrogenase, FAD-binding Fe-S subunit (Escherichia coli K-12 substr. MG1655)
Carboxylate reductase. [EC: 1.2.99.6]; 1.2.98.- [EC: 1.2.99.6]; 1.2.98.- [EC: 1.2.99.6]

Predicted SEED Role

"Periplasmic aromatic aldehyde oxidoreductase, FAD binding subunit YagS" in subsystem Purine Utilization

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.17.1.4

Use Curated BLAST to search for 1.17.1.4 or 1.2.99.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (316 amino acids)

>GFF2171 Aldehyde oxidoreductase FAD-binding subunit PaoB (Xanthobacter sp. DMC5)
MRPFTYERALTPADAAGAAAATPGARFIAGGTNLLDLMKLQIETPAHLIDVNGLGLDRIE
ASENGGLRIGALVRNTDLAADARVRRDYPVLSRALLAGASAQLRNKATTAGNLLQRTRCP
YFYDPAQACNKRAPGSGCAAMGGYSRQLAIIGGSDACIATHPSDMAVAMRALDAVVETVG
PTGTTRQIAMADFHRLPGDTPHIETALEPGELITAVTLPKPAGGRQVYRKVRDRASYAFA
LVSVAAVIQEDGTGRIALGGVAHKPWRVEEAEAELPRGAKAVSERLLAGARPTPENAFKV
TLVERTLGAVLADGRN