Protein Info for GFF2168 in Variovorax sp. SCN45

Annotation: High-affinity branched-chain amino acid transport system permease protein LivH (TC 3.A.1.4.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 307 transmembrane" amino acids 6 to 30 (25 residues), see Phobius details amino acids 42 to 59 (18 residues), see Phobius details amino acids 79 to 99 (21 residues), see Phobius details amino acids 111 to 132 (22 residues), see Phobius details amino acids 158 to 176 (19 residues), see Phobius details amino acids 197 to 249 (53 residues), see Phobius details amino acids 256 to 275 (20 residues), see Phobius details amino acids 281 to 300 (20 residues), see Phobius details PF02653: BPD_transp_2" amino acids 9 to 291 (283 residues), 105.7 bits, see alignment E=1.2e-34

Best Hits

KEGG orthology group: K01997, branched-chain amino acid transport system permease protein (inferred from 73% identity to axy:AXYL_06412)

Predicted SEED Role

"High-affinity branched-chain amino acid transport system permease protein LivH (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (307 amino acids)

>GFF2168 High-affinity branched-chain amino acid transport system permease protein LivH (TC 3.A.1.4.1) (Variovorax sp. SCN45)
MVVALLQALISGLAVGGAYALVALGFSITFTTTKTLNFSHGEFVSAGAFIGMSALFLVLG
KPFDSTTFGDAIPGAGAQLFALVAALGVMGLLGWLLYVLGVRPFAGRPGMAWVMSTLGFG
VILQSVGLAIWGPKPVVVPAPVGDTVLRMFGVGVRPQELLTLGVAVVVMFGFDRVMNRTM
VGKAMRAVAQNGNVASLMGINTNAMMIGAFVVSSALAGLSGFLLAPIAQASLFMGLTVGL
KGFSGAMIGGLSNPRGCVIGGFLLGVLESMVNLWQAQWREVAVFALVILVLAFRPTGLFG
RSTVEKV