Protein Info for GFF2164 in Xanthobacter sp. DMC5

Annotation: Macrolide export protein MacA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 430 transmembrane" amino acids 29 to 47 (19 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 61 to 405 (345 residues), 170 bits, see alignment E=3.1e-54 PF25917: BSH_RND" amino acids 83 to 238 (156 residues), 51.7 bits, see alignment E=1.6e-17 PF25876: HH_MFP_RND" amino acids 130 to 206 (77 residues), 35 bits, see alignment E=3.7e-12 PF25967: RND-MFP_C" amino acids 349 to 407 (59 residues), 37.9 bits, see alignment E=3.4e-13

Best Hits

KEGG orthology group: K13888, macrolide-specific efflux protein MacA (inferred from 72% identity to xau:Xaut_2452)

Predicted SEED Role

"Macrolide-specific efflux protein MacA" in subsystem Multidrug Resistance Efflux Pumps

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (430 amino acids)

>GFF2164 Macrolide export protein MacA (Xanthobacter sp. DMC5)
VNALPPLDETRTAPAAGATRTKKKPRRRLWRWGLLALLIAAGAYGYSRYTAPVPGTGLMT
APVTRGNLEETVLASGTLKPSNLVAVGSQASGRILSIKVKLGDEVKKGDLIAQIDSVTQE
NSLRTAEAALANTRAQKAEKEATLVLNEQTLARQKTMVAQKAVSQADFEAADSAVKVTRA
QLAALDAQIISAQVAVDTARANLGYTQITAPVDGTVLALVAQQGQTLNATQTAPTVAILG
QLDVMMVRAEISEADIIKVAPGMPLWFTVVGAPDERHYAKLGFIEPAPESLKNDSIFSTT
SSSSSSSSSSSTTSSAIYYIGVFDVPNPKGRLRTYMTPEVHIILGRAENVLTVPSTALER
AGKGWRVRVLHGDGTVERRPVEVGLNDKVTAEIRSGLAEGERVVTGEAVGGASGGGAGGP
PRRPPPMGGL