Protein Info for PS417_11010 in Pseudomonas simiae WCS417

Annotation: FAH family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

No protein families (PFam or TIGRFam), signal peptides, or transmembrane helices were found in this protein.

Best Hits

KEGG orthology group: None (inferred from 94% identity to pfs:PFLU2369)

MetaCyc: 69% identical to 2-keto-3-deoxy-L-lyxonate dehydratase (Pseudomonas aeruginosa PAO1)
2-dehydro-3-deoxy-L-arabinonate dehydratase. [EC: 4.2.1.43]

Predicted SEED Role

"SUGAR TRANSPORTER"

MetaCyc Pathways

• L-arabinose degradation III (5/6 steps found)
• L-lyxonate degradation (2/3 steps found)
• superpathway of pentose and pentitol degradation (16/42 steps found)

KEGG Metabolic Maps

• Ascorbate and aldarate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.43

Sequence Analysis Tools

See A0A1N7U2L2 at UniProt or InterPro

Protein Sequence (329 amino acids)

>PS417_11010 FAH family protein (Pseudomonas simiae WCS417)
MRLVQFELSNGERRVGVVEGDSLREVQTARSVRELALAAIEAGVGLAQQVNNLGLGDSHD
YATLLAGLKILPPLDHPDPAHMLISGTGLTHLGSASARDKMHQAGDDTALTDTMRIFKWG
VEGGKPAAGQAGVQPEWFYKGDGSNVVRPGAAFPVPPFAEDAGEEPEIGGLYVIGPDSKP
YRVGFAVGNEFSDHVMERKNYLYLAHSKLRSCSYGPELRVGELPQHLAGTSRIVRNGEEI
WRNEFLSGEANMCHSLENLEYHHFKYRQFLKPGDVHIHFFGTATLSFADGIRTQPGDVFE
ISQADFGAPLVNRVGSSDAAFEPGNVITL