Protein Info for GFF2158 in Variovorax sp. SCN45

Annotation: Putative pre-16S rRNA nuclease YqgF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 149 PF03652: RuvX" amino acids 25 to 146 (122 residues), 115.7 bits, see alignment E=1e-37 TIGR00250: putative transcription antitermination factor YqgF" amino acids 27 to 145 (119 residues), 93.5 bits, see alignment E=5.6e-31

Best Hits

Swiss-Prot: 77% identical to YQGF_POLSJ: Putative pre-16S rRNA nuclease (Bpro_1143) from Polaromonas sp. (strain JS666 / ATCC BAA-500)

KEGG orthology group: K07447, putative holliday junction resolvase [EC: 3.1.-.-] (inferred from 89% identity to vap:Vapar_4616)

MetaCyc: 45% identical to ribonuclease H-like domain-containing nuclease (Escherichia coli K-12 substr. MG1655)
Exodeoxyribonuclease I. [EC: 3.1.11.1]

Predicted SEED Role

"Putative Holliday junction resolvase YqgF"

Isozymes

Compare fitness of predicted isozymes for: 3.1.-.-, 3.1.11.1

Use Curated BLAST to search for 3.1.-.- or 3.1.11.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (149 amino acids)

>GFF2158 Putative pre-16S rRNA nuclease YqgF (Variovorax sp. SCN45)
MPDAPAPAASASSSVPAAVPAHFQTFLAFDYGLKRTGVASGNRLLGTATPQATIKAEGAD
ARFAQVEARIKEWQPDALVVGVPYHPDGAPHENTRRAQKFARQMRGRFNLQVFEVDERYS
TTEALSSGARDADAASACIILEQFLRSLT