Protein Info for GFF2148 in Xanthobacter sp. DMC5

Annotation: Putative aliphatic sulfonates transport permease protein SsuC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 281 transmembrane" amino acids 37 to 57 (21 residues), see Phobius details amino acids 92 to 114 (23 residues), see Phobius details amino acids 126 to 145 (20 residues), see Phobius details amino acids 151 to 170 (20 residues), see Phobius details amino acids 191 to 208 (18 residues), see Phobius details amino acids 214 to 235 (22 residues), see Phobius details amino acids 247 to 265 (19 residues), see Phobius details PF00528: BPD_transp_1" amino acids 103 to 272 (170 residues), 102.2 bits, see alignment E=1.5e-33

Best Hits

Swiss-Prot: 39% identical to Y3424_BRUAB: Probable ABC transporter permease protein BruAb2_1124 (BruAb2_1124) from Brucella abortus biovar 1 (strain 9-941)

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 88% identity to rpt:Rpal_4641)

Predicted SEED Role

"FIG01004675: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (281 amino acids)

>GFF2148 Putative aliphatic sulfonates transport permease protein SsuC (Xanthobacter sp. DMC5)
MGANAEAGAMTAVPDSSAPAARKMPWSRLLADKSVRAGLGLAAFFAFWQAVTGLGLVDGF
LLPSPFAVAQALWEMAVDGSLWIHLAASLQRVAVGFLLACVVGLALGLVCGWWRSVSDFV
RPVVEALRPIPPLAWIPITILWFGLGDAASYFLVFLGAVFPAFVATYTAVRGLDRNQMNA
ALCLGAKPWQLFWDVLIPASLPIILPGLRIALGVGWMCVVTAELIAAQTGLGYLIQQSRM
LFQINNVVAGMVTIGLVGFAMSAILERIERRVNAWAPSERN