Protein Info for PS417_10950 in Pseudomonas simiae WCS417

Annotation: AraC family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 391 PF22177: PBP1_XylR" amino acids 9 to 107 (99 residues), 144.7 bits, see alignment E=2.6e-46 PF00532: Peripla_BP_1" amino acids 50 to 257 (208 residues), 22.4 bits, see alignment E=2.3e-08 PF13407: Peripla_BP_4" amino acids 98 to 260 (163 residues), 36.8 bits, see alignment E=9.8e-13 PF13377: Peripla_BP_3" amino acids 115 to 275 (161 residues), 126.1 bits, see alignment E=4.5e-40 PF12833: HTH_18" amino acids 311 to 388 (78 residues), 65.3 bits, see alignment E=1.6e-21 PF00165: HTH_AraC" amino acids 350 to 388 (39 residues), 47.9 bits, see alignment 3.3e-16

Best Hits

Swiss-Prot: 47% identical to XYLR_ECOLI: Xylose operon regulatory protein (xylR) from Escherichia coli (strain K12)

KEGG orthology group: K02529, LacI family transcriptional regulator (inferred from 95% identity to pfs:PFLU2302)

Predicted SEED Role

"Xylose activator XylR (AraC family)" in subsystem Xylose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UAI9 at UniProt or InterPro

Protein Sequence (391 amino acids)

>PS417_10950 AraC family transcriptional regulator (Pseudomonas simiae WCS417)
MKTLPPVHRIALLFNGSKIYDRGIIAGIGNYLSSTRASWDLFLEEDFLCRLKGIERWQGD
GIIADFDDPLIGEALAGSKLPVVAVGGSYEDVRAYPKGMPYVATDNYALIKLAYEHLIEA
GLTRFACFSLPEAQANRWAQEREKAFRRLLQRDGLQVEVYRGLGTSAPLWDSAVEQQIAW
LHSLPKPIGIIAVTDARARQLLQACLTAGIAVPEEVALIGIDNDPLTRTLTRVPLSSVIQ
GTETMGRTAAALLHQMLHGKPCRGEQILVPPDAINVQASSLHQPLGNPYVMQALLFIRQY
ACQGIKTAQVAGYVGVSRSSLETHFRKARGCSVHDEILRFKLAAAAKGLQNQALAIADIA
QACGFKSAQYLHTVFRREFGCTPREYQQSEA