Protein Info for GFF2146 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details PF13379: NMT1_2" amino acids 35 to 246 (212 residues), 35.1 bits, see alignment E=2e-12 PF12974: Phosphonate-bd" amino acids 62 to 204 (143 residues), 30.3 bits, see alignment E=4.1e-11 PF09084: NMT1" amino acids 63 to 249 (187 residues), 53.5 bits, see alignment E=4.8e-18

Best Hits

KEGG orthology group: None (inferred from 80% identity to rpt:Rpal_4643)

Predicted SEED Role

"possible aliphatic sulfonate binding protein of ABC transporter system"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (350 amino acids)

>GFF2146 hypothetical protein (Xanthobacter sp. DMC5)
VTSGLSRRRFGQLAAGFAASLPLAAPSILRAQEGDVVRMCWFNTTTVSAQIAHVLMRTDI
PARNGLKMEMIQLAASPAITEALVSGAGDVGTLSDFAAVTTMAIGAPVTTVSSQARFRSA
VLATKKSGITKMSDLKGKQVYGTFGITAFQNAQDAVLKAGLVPGKDMTFVNVGPAELADA
VGAQRIDAFFTYDPFVSFFESTGNAVVVSENLSPVIVLAANNRFLQKPDVLRRLLLANAQ
ALFFAAQNNDLANSWFRSLEPAKNIPEPVLQKASSYDPAWSAKTFTDIKVALSPAQIAQM
ETLAKWGVEAKLLPRLPDVPKFVNTAIAGEVDKEIATGSFDVKSVKILRA