Protein Info for GFF2145 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: ABC transporter ATP-binding/permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 844 transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 37 to 56 (20 residues), see Phobius details amino acids 64 to 81 (18 residues), see Phobius details amino acids 87 to 109 (23 residues), see Phobius details amino acids 115 to 134 (20 residues), see Phobius details amino acids 161 to 179 (19 residues), see Phobius details amino acids 212 to 234 (23 residues), see Phobius details amino acids 249 to 274 (26 residues), see Phobius details amino acids 286 to 309 (24 residues), see Phobius details PF02653: BPD_transp_2" amino acids 32 to 298 (267 residues), 140.1 bits, see alignment E=2.7e-44 PF00005: ABC_tran" amino acids 366 to 521 (156 residues), 91.1 bits, see alignment E=3.7e-29 amino acids 626 to 773 (148 residues), 113.4 bits, see alignment E=4.9e-36

Best Hits

KEGG orthology group: None (inferred from 76% identity to vei:Veis_4701)

Predicted SEED Role

"ABC transporter ATP-binding/permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (844 amino acids)

>GFF2145 ABC transporter ATP-binding/permease protein (Hydrogenophaga sp. GW460-11-11-14-LB1)
MPAFLKNKHRALWIGALGLVLLPIVFQAIGLTLDSATVVVILAMAAMGLNLLVGYTGLVS
FGHAAWFGIGGYAAGLAQLHWFKNQMLLPMLFSVLFTAALSLIVGFLILRRRGVYFSLLT
LALCALTFAISFRWTSLTGGEGGLGGIERATFGPIDLNSHLSYYVFAALIGFAVLVLLHR
IVRSPFGHVLVAIRENQQRATFQGYDVERYKLLAFVLSATVTGLAGSLMVFLHRLAAAES
TAVHFSGELLAMVVIGGMHSFLGPALGAVFFLLFRELFSMWTDNWLLWFGLIFVGFIVFS
PSGLTGIWGQIQRRLRPPPEDGAAMSKRKIYEGLPLPEFLRPKRREGAVLEASEVGMRFG
GIQAVRGANLRVEAGQIHALIGPNGAGKTTTFNLISGMFPPSTGTVRLHGQPIHQLAPDR
ICQQGLARSFQITNLFKGLTIEENLRLSLQARHAARFNFWRDIDSYPEIHAETAELMKFL
GLQGMEAVGGGDLSYGGQRLVDLGIALGSKPQVLLMDEPLAGLAAAERERVSRLVKTIAS
NIPVLIVEHDIDRVLELSHRVTVMNQGEVLMSGTPDQVRDDQRVQEIYTGTGTPPVTGRT
GVATADRPVVLDFHKVNAFYGKSHILNDASLQVREGEIVALLGRNGAGKSTLLKSLMGLV
PPANGRVHFNGQELAGLPAPDIARRGVGYVPQGRGLFAGMTVAENLSLGRLARPTDGSTG
VVWDEARIFEYFPRLKERMHVAADYLSGGEQQMVAVARALSGNVKLLLLDEPFEGLAPTV
VQELFTVFDKLRQHISIVIVEHNLDLVLALADRVYALERGAVFHEGPAQPLLTDLDYRKK
ILWL