Protein Info for PS417_10935 in Pseudomonas simiae WCS417

Annotation: xylose transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 518 TIGR02633: D-xylose ABC transporter, ATP-binding protein" amino acids 8 to 507 (500 residues), 915.5 bits, see alignment E=3.6e-280 PF00005: ABC_tran" amino acids 24 to 176 (153 residues), 100.2 bits, see alignment E=1.6e-32 amino acids 284 to 438 (155 residues), 75.5 bits, see alignment E=6.7e-25 PF13304: AAA_21" amino acids 394 to 467 (74 residues), 27.8 bits, see alignment E=2.6e-10

Best Hits

Swiss-Prot: 92% identical to XYLG_PSEU2: Xylose import ATP-binding protein XylG (xylG) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K10545, D-xylose transport system ATP-binding protein [EC: 3.6.3.17] (inferred from 97% identity to pfs:PFLU2299)

Predicted SEED Role

"D-xylose transport ATP-binding protein XylG" in subsystem Xylose utilization

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.17

Use Curated BLAST to search for 3.6.3.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UDY6 at UniProt or InterPro

Protein Sequence (518 amino acids)

>PS417_10935 xylose transporter (Pseudomonas simiae WCS417)
MTAMSDYLLQMNGIVKSFGGVNALNGIDIRVRPGECVGLCGENGAGKSTLMKVLSAVYPY
GTWEGEILWDGQPLKAQSISETEAAGIVIIHQELTLVPDLSVAENIFMGHELTLPGGRMN
YPAMFHRAEALMRELKVPDMNVALPVSQYGGGYQQLVEIAKALNKQARLLILDEPSSALT
RSEIEVLLDIIRGLKAKGVACVYISHKLDEVAAVCDTIAVIRDGKHIATTAMADMDIAKI
ITQMVGREMSNLYPTEPHAVGEVIFEARNVTCHDVDNPKRKRVDDVSFVLKRGEILGIAG
LVGAGRTELVSALFGAYPGRYSAEVWLDGQVIDTRTPLKSIRAGLCMVPEDRKRQGIIPD
LGVGQNITLTVLDSYAHRTRIDAEAELGSIDQQIARMHLKTASTFLPITSLSGGNQQKAV
LAKMLMAKPKVLILDEPTRGVDVGAKYEIYKLMGALAAEGVAIIMVSSELAEVLGVSDRV
LVIGDGQLRGDFINEGLTQEQVLAAALSQHNNNDRKTV