Protein Info for GFF2144 in Variovorax sp. SCN45

Annotation: tRNA-dihydrouridine synthase DusB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 353 TIGR00737: putative TIM-barrel protein, nifR3 family" amino acids 5 to 322 (318 residues), 382 bits, see alignment E=1.1e-118 PF01207: Dus" amino acids 16 to 318 (303 residues), 322.6 bits, see alignment E=2.5e-100 PF00977: His_biosynth" amino acids 152 to 245 (94 residues), 26.9 bits, see alignment E=3.2e-10

Best Hits

Swiss-Prot: 60% identical to DUSB_XANAC: tRNA-dihydrouridine synthase B (dusB) from Xanthomonas axonopodis pv. citri (strain 306)

KEGG orthology group: K05540, tRNA-dihydrouridine synthase B [EC: 1.-.-.-] (inferred from 95% identity to vpe:Varpa_5234)

MetaCyc: 54% identical to tRNA-dihydrouridine synthase B (Escherichia coli K-12 substr. MG1655)
1.1.1.-

Predicted SEED Role

"tRNA dihydrouridine synthase B (EC 1.-.-.-)" (EC 1.-.-.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (353 amino acids)

>GFF2144 tRNA-dihydrouridine synthase DusB (Variovorax sp. SCN45)
MTLQIGTHTLENRLFVAPMAGVTDRPFRMLCRALGAGYAVSEMVTSRKELWGTLKTSRRA
NHDGEPGPIAVQIAGTDADMMAEATVYNIERGAQIIDINMGCPAKKVCNKWAGSALMRDE
PLALEIVQAVVDAARPFNVPVTLKMRTGWSHDHRNAVKLARDFESAGVQMLTVHGRTREQ
GYKGHAEYDTIAAVKAAVRVPVVANGDIRSPEKARDVLAATGADAVMIGRAAQGRPWIFR
EIAHFLETGTHRAPPLVAEVRRLLLDHLVEHYALYGDYSGVRTARKHIGWYVRTLPEGEA
FRARMNTIEDCGEQLRAVGDYFDGLADRMERMPVQHEADNELSGEEEAACAVD