Protein Info for PS417_10930 in Pseudomonas simiae WCS417

Annotation: D-xylose ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 378 transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 44 to 63 (20 residues), see Phobius details amino acids 71 to 91 (21 residues), see Phobius details amino acids 97 to 116 (20 residues), see Phobius details amino acids 123 to 147 (25 residues), see Phobius details amino acids 160 to 182 (23 residues), see Phobius details amino acids 202 to 219 (18 residues), see Phobius details amino acids 225 to 244 (20 residues), see Phobius details amino acids 272 to 292 (21 residues), see Phobius details amino acids 353 to 371 (19 residues), see Phobius details PF02653: BPD_transp_2" amino acids 40 to 367 (328 residues), 124.2 bits, see alignment E=2.8e-40

Best Hits

Swiss-Prot: 54% identical to XYLH_HAEIN: Xylose transport system permease protein XylH (xylH) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K10544, D-xylose transport system permease protein (inferred from 98% identity to pfs:PFLU2298)

Predicted SEED Role

"Xylose ABC transporter, permease protein XylH" in subsystem Xylose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U0M2 at UniProt or InterPro

Protein Sequence (378 amino acids)

>PS417_10930 D-xylose ABC transporter permease (Pseudomonas simiae WCS417)
MNQVKHLFTRYKMLALVIAVAVIWVFFSWQTEGGFLTPRNLSNLLRQMSITGILACGMVL
VIISGEIDLSVGSLLGLLGGLAAILDVVYHIPLLANLSLVALCGLMIGLANGYMTAYLRI
PSFIVGLGGMLAFRGILLGITGGTTIAPVSPSLVYVGQGYLPHSVGIGLGVLLFSLTVFL
TWKQRRNRALHGLAAHSLVRDLVRVAVIGAVLAGFVTTLNSYDGIPVPVLLLLVLLGVFS
YVTSQTVFGRRVYAVGSNMEATRLSGINVQAVKLWIFGIMGVMCALAGLVNTARLAAGSP
SAGNMGELDAIAACFIGGTSMRGGSGTVYGALLGALVITSLDNGMSMLDVDSYWQMIVKG
SILVLAVWVDVSTRAGRR