Protein Info for GFF2140 in Variovorax sp. SCN45

Annotation: Ribose ABC transporter, substrate-binding protein RbsB (TC 3.A.1.2.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 317 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF00532: Peripla_BP_1" amino acids 31 to 304 (274 residues), 80 bits, see alignment E=3.3e-26 PF13407: Peripla_BP_4" amino acids 33 to 295 (263 residues), 181 bits, see alignment E=4.8e-57 PF13377: Peripla_BP_3" amino acids 170 to 293 (124 residues), 33.5 bits, see alignment E=6.8e-12

Best Hits

KEGG orthology group: K10439, ribose transport system substrate-binding protein (inferred from 97% identity to vpe:Varpa_5241)

Predicted SEED Role

"Ribose ABC transport system, periplasmic ribose-binding protein RbsB (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (317 amino acids)

>GFF2140 Ribose ABC transporter, substrate-binding protein RbsB (TC 3.A.1.2.1) (Variovorax sp. SCN45)
MKFTRRTLQSAAALTLLGAIVATPAFAQDKPKVALVMKSLANEFFRTMEDGAKAHQKANA
AQYTLVANGIKDETDTAAQIKMVEQMVAQKINALVIAPADSKALVPVIKTAIDKGILVVN
IDNQLDAAALKEKGIQVPFVGPDNRAGAKLVGDALAKELKSGDKVGIIEGVSTTFNAQQR
TLGYQDAMKAAGVTVVGVQSGQWEIDKGNTVAAGMLREHPDLKALLAGNDSMALGAVAAV
KAAGKTGKVLVVGYDNIGAIKPMLADGRVLATADQFAAKQAVFGIETALKAIADKKKQSE
MPAEVKTDVVLVTKSSK