Protein Info for GFF214 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 382 TIGR01368: carbamoyl-phosphate synthase, small subunit" amino acids 5 to 375 (371 residues), 509.5 bits, see alignment E=2.3e-157 PF00988: CPSase_sm_chain" amino acids 7 to 132 (126 residues), 179.6 bits, see alignment E=3.1e-57 PF00117: GATase" amino acids 196 to 372 (177 residues), 196.5 bits, see alignment E=5.4e-62 PF07722: Peptidase_C26" amino acids 250 to 325 (76 residues), 24 bits, see alignment E=4.6e-09

Best Hits

Swiss-Prot: 100% identical to CARA_SALTY: Carbamoyl-phosphate synthase small chain (carA) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K01956, carbamoyl-phosphate synthase small subunit [EC: 6.3.5.5] (inferred from 97% identity to sty:STY0076)

MetaCyc: 94% identical to carbamoyl-phosphate synthetase small subunit (Escherichia coli K-12 substr. MG1655)
Carbamoyl-phosphate synthase (glutamine-hydrolyzing). [EC: 6.3.5.5]

Predicted SEED Role

"Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)" in subsystem De Novo Pyrimidine Synthesis or Macromolecular synthesis operon (EC 6.3.5.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.3.5.5

Use Curated BLAST to search for 6.3.5.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (382 amino acids)

>GFF214 Carbamoyl-phosphate synthase small chain (EC 6.3.5.5) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
LIKSALLVLEDGTQFHGRAIGATGSAVGEVVFNTSMTGYQEILTDPSYSRQIVTLTYPHI
GNVGTNKADEESSQVHAQGLVIRDLPLIASNFRNTEDLSSYLKRHNIVAIADIDTRKLTR
LLREKGAQNGCIIAGDSPDAKLALEKAKAFPGLNGMDLAKEVTTAETYRWTQGSWTLKDG
LPEAKSEDDLPFHVVAYDFGAKRNILRMLVDRGCRLTVVPAQTSAEEVLKMNPDGIFLSN
GPGDPAPCDYAITAIQKFLETDIPLFGICLGHQLLALASGAKTVKMKFGHHGGNHPVKDM
DRNVVMITAQNHGFAVDEDSLPANLRVTHKSLFDGTLQGIHRTDKPAFSFQGHPEASPGP
HDAAPLFDHFIELIEQYRQSAK