Protein Info for GFF2138 in Variovorax sp. SCN45

Annotation: Ribose ABC transporter, permease protein RbsC (TC 3.A.1.2.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 329 transmembrane" amino acids 20 to 45 (26 residues), see Phobius details amino acids 57 to 75 (19 residues), see Phobius details amino acids 80 to 98 (19 residues), see Phobius details amino acids 105 to 128 (24 residues), see Phobius details amino acids 166 to 189 (24 residues), see Phobius details amino acids 219 to 237 (19 residues), see Phobius details amino acids 249 to 269 (21 residues), see Phobius details amino acids 276 to 297 (22 residues), see Phobius details amino acids 303 to 319 (17 residues), see Phobius details PF02653: BPD_transp_2" amino acids 51 to 314 (264 residues), 157.6 bits, see alignment E=1.9e-50

Best Hits

KEGG orthology group: K10440, ribose transport system permease protein (inferred from 96% identity to vpe:Varpa_5243)

Predicted SEED Role

"Ribose ABC transport system, permease protein RbsC (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (329 amino acids)

>GFF2138 Ribose ABC transporter, permease protein RbsC (TC 3.A.1.2.1) (Variovorax sp. SCN45)
MNAAATPTTSASPSALKGQLGTYLGLTVVLVGMIALFGSLSEYFLTRETFVSIANEIPAL
AVMAVGMTFVLIIAGIDLSVGSVLALSAAVTAAAILEWKLSVPLAAVLGLATGLICGTVT
GAVSVAWRLPSFIVSLGMLEAVRGGAYLVTDSRTQYVGDAISGLAAPWIGGISAAFVLAV
VLVVIGQMVLTRTVFGRHVVGIGTNEEAMRLAGVDPRPVRIIVFAVTGLLAGLAGLMQSA
RLEAADPNAGVGIELQVIAAVVIGGTSLMGGRGSVVNTFFGVLIIAVLEAGLAQVGASEP
SKRIITGAVIVVAVIIDTLRQRRADRRLD