Protein Info for GFF2137 in Variovorax sp. SCN45

Annotation: Ribose operon repressor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 365 PF00356: LacI" amino acids 3 to 48 (46 residues), 65.8 bits, see alignment 4.7e-22 PF00532: Peripla_BP_1" amino acids 60 to 322 (263 residues), 117.7 bits, see alignment E=1.4e-37 PF13407: Peripla_BP_4" amino acids 63 to 280 (218 residues), 63.4 bits, see alignment E=5.1e-21 PF13377: Peripla_BP_3" amino acids 170 to 335 (166 residues), 149.4 bits, see alignment E=2.1e-47

Best Hits

KEGG orthology group: K02529, LacI family transcriptional regulator (inferred from 90% identity to vap:Vapar_4639)

Predicted SEED Role

"Ribose operon repressor" in subsystem D-ribose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (365 amino acids)

>GFF2137 Ribose operon repressor (Variovorax sp. SCN45)
MATIKDVALQAEVSVTTVSHVVNDTRHVSAKVRERVELAIRELGYVPNAMARSLKSNTTS
TLGMLIPNSSNPYFAEIVRIVEDRCFGAGYTLVLCNTDDEPHRQSVYLQVLAERRIDGLI
VVLTGTGDDDALVKQLHGLRVPTVLVDREIADPACDLVETAHMQGGLLAVRHLLSLGHKR
IACIGGQAGVMPSEQRIEGWRMALAEAGATPDIANGDALLWRGGFTSQGGYEAMHAILRT
ERKPSAVFVCNDLMAIGALRAAHESGVRVPDDLSIVGFDDIELSAYTSPPLTTVAQPKER
IGAMAVDMLLEQMGGKRRDARKVVLQPELRVRASTARHASFREATVVPAAAETPSSTETR
KSRTP