Protein Info for GFF2136 in Variovorax sp. SCN45

Annotation: Ribokinase (EC 2.7.1.15)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 321 PF00294: PfkB" amino acids 15 to 305 (291 residues), 231.3 bits, see alignment E=1.8e-72 TIGR02152: ribokinase" amino acids 16 to 309 (294 residues), 329.8 bits, see alignment E=8.1e-103 PF08543: Phos_pyr_kin" amino acids 171 to 289 (119 residues), 33 bits, see alignment E=4.2e-12

Best Hits

Swiss-Prot: 42% identical to RBSK_ECO57: Ribokinase (rbsK) from Escherichia coli O157:H7

KEGG orthology group: K00852, ribokinase [EC: 2.7.1.15] (inferred from 90% identity to vpe:Varpa_5245)

MetaCyc: 42% identical to ribokinase (Escherichia coli K-12 substr. MG1655)
Ribokinase. [EC: 2.7.1.15]

Predicted SEED Role

"Ribokinase (EC 2.7.1.15)" in subsystem D-ribose utilization or Deoxyribose and Deoxynucleoside Catabolism (EC 2.7.1.15)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (321 amino acids)

>GFF2136 Ribokinase (EC 2.7.1.15) (Variovorax sp. SCN45)
VSLKPSSSSPAPSPRIVVLGSLNMDLVLRVPHAPAAGETLLGHSIANIPGGKGANQAVSC
AREGAQVQMIGCVGDDAHGTALREALERDGIDTAALRTVAGEPTGTALILVEDSGQNRIV
MIPGANARVEIDEAALKRQVQGAAFLVAQFETPLDQVARAISAAHGAGCKVLLNPSPVQP
IAEPLWQRIDTLVVNEIEAQTLCGQPADSPLEAAAAGRALRAKGIARVVVTLGARGAVAV
DADGARHHPAPKVQAVDTTAAGDTFLGALAVALGEGQSFDEAVRLGIRAAALCIQQPGAQ
PSIPQRDAVLRSPLPPDWITL