Protein Info for GFF2134 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: TcuB: works with TcuA to oxidize tricarballylate to cis-aconitate

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 390 transmembrane" amino acids 121 to 141 (21 residues), see Phobius details amino acids 161 to 181 (21 residues), see Phobius details amino acids 241 to 262 (22 residues), see Phobius details amino acids 274 to 294 (21 residues), see Phobius details amino acids 314 to 333 (20 residues), see Phobius details amino acids 339 to 359 (21 residues), see Phobius details TIGR02484: CitB domain protein" amino acids 22 to 381 (360 residues), 407 bits, see alignment E=4e-126

Best Hits

Swiss-Prot: 66% identical to CITB_SALTY: Citrate utilization protein B (citB) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K13795, citrate/tricarballylate utilization protein (inferred from 84% identity to pna:Pnap_3814)

MetaCyc: 66% identical to FADH2:quinone oxidoreductase (Salmonella enterica enterica serovar Typhimurium str. LT2)
RXN-20072

Predicted SEED Role

"TcuB: works with TcuA to oxidize tricarballylate to cis-aconitate" in subsystem Tricarballylate Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (390 amino acids)

>GFF2134 TcuB: works with TcuA to oxidize tricarballylate to cis-aconitate (Hydrogenophaga sp. GW460-11-11-14-LB1)
MQALEALARDARALAQGEVVLSAPETEVARQMQICNACRYCEGFCAVFPAMTRRLEFGKA
DIHFLANLCHNCGACLHACQYAPPHEFAVNVPKAMAEVRGQTYADYAWPPALGRLYQRNG
LTLSVALAAGLALFLLLAVALKGSLWPSDLAGNFYNLFPHNLLVSLFAPVFLFVVFALGM
GVTRFWRDVTPATSGAALNLPATGEAAHDALRLKYLDGGHGDGCHNEDDAYTLSRRRYHH
FTFYGFMLCFAATSVATLYHYVFGWVAPYELPSLPKLLGVVGGVSLLIGTTGLWRLNRRR
HPLHGDVAQKPMDLGFIALLFLTSATGLALWLARGTPALAVMLCLHLGAVMALFATLPYG
KFAHGVFRTASLLRFAVEKRQPNPVGLGAD