Protein Info for PS417_10880 in Pseudomonas simiae WCS417

Updated annotation (from data): cytochrome c component of deoxyribose dehydrogenase
Rationale: Specifically important in carbon source 2-Deoxy-D-Ribose. This gene is in a conserved cluster with the iorAB-like subunits of deoxyribose dehydrogenase and has a similar (if weaker) fitness pattern. It is probably the electron acceptor in vivo.
Original annotation: alcohol dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 447 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF00034: Cytochrom_C" amino acids 208 to 306 (99 residues), 22.6 bits, see alignment E=2.3e-08 amino acids 329 to 415 (87 residues), 51.9 bits, see alignment E=1.7e-17 PF13442: Cytochrome_CBB3" amino acids 328 to 411 (84 residues), 41.6 bits, see alignment E=1.3e-14

Best Hits

KEGG orthology group: None (inferred from 93% identity to pfs:PFLU2270)

MetaCyc: 51% identical to D-gluconate dehydrogenase cytochrome c subunit (Pseudomonas fluorescens)
Gluconate 2-dehydrogenase (acceptor). [EC: 1.1.99.3]

Predicted SEED Role

"Putative diheme cytochrome c-553" in subsystem Soluble cytochromes and functionally related electron carriers

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.99.3

Use Curated BLAST to search for 1.1.99.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U0L4 at UniProt or InterPro

Protein Sequence (447 amino acids)

>PS417_10880 cytochrome c component of deoxyribose dehydrogenase (Pseudomonas simiae WCS417)
MNNRRFARTAGWLALPCLVAAGLLAWYVTREPATPFEQEQAGATFEPALVSRGEYVARLS
DCVACHSLAGKAPFAGGLEMATPLGAIHATNITPDKSTGIGTYSLADFDRAVRHGVAPGG
RRLYPAMPYPSYVKLSDDDIKALYAFFMQGIKPANQPNIPSDIPWPLNMRWPIALWNGVF
APTATYAAKPDQDALWNRGAYIVQGPGHCGSCHTPRGLAFNEKALDEAGAPFLAGALLDG
WYAPSLRQDPNTGLGRWSEPQIVQFLKTGRNAHAVVYGSMTEAFNNSTQFMQDDDLAAIA
RYLKSLPGDPQRDGAPWQYQAVAAVQDAPGAHTYATRCASCHGLDGKGQPEWMPPLAGAT
SALAKESASAINITLNGSQRVVASGVPDAYRMPAFREQLSDTEIAEVLSYVRSTWGNNGG
AVDANAVGKLRGHTDPASSSPIILHMR