Protein Info for GFF2133 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: TcuA: flavoprotein used to oxidize tricarballylate to cis-aconitate

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 471 PF01266: DAO" amino acids 5 to 121 (117 residues), 34.4 bits, see alignment E=5.6e-12 amino acids 130 to 194 (65 residues), 30.2 bits, see alignment E=1.1e-10 TIGR02485: precorrin 3B synthase CobZ" amino acids 5 to 462 (458 residues), 729.3 bits, see alignment E=7.4e-224 PF12831: FAD_oxidored" amino acids 5 to 165 (161 residues), 36.2 bits, see alignment E=1.4e-12 PF00890: FAD_binding_2" amino acids 5 to 433 (429 residues), 107.2 bits, see alignment E=3.5e-34

Best Hits

KEGG orthology group: K13796, tricarballylate dehydrogenase (inferred from 87% identity to dia:Dtpsy_3415)

MetaCyc: 80% identical to propane-1,2,3-tricarboxylate dehydrogenase (Salmonella enterica enterica serovar Typhimurium str. LT2)
1.3.8.M1 [EC: 1.3.8.M1]

Predicted SEED Role

"TcuA: flavoprotein used to oxidize tricarballylate to cis-aconitate" in subsystem Tricarballylate Utilization

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.8.M1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (471 amino acids)

>GFF2133 TcuA: flavoprotein used to oxidize tricarballylate to cis-aconitate (Hydrogenophaga sp. GW460-11-11-14-LB1)
LEEPDVLVIGGGNAALCAALMAREAGASVLLLEAAPREWRGGNSGHTRNLRCMHDAPQDV
LVEAYPEEEFWQDLLKVTGGQTNEHLARLTIRASSTCRDWMRKHGVHFQPPLSGALHVAR
TNAFFMGGGKALVNAYYRSAENLGVRVRYETPVDRIEVQDGRFVAALTRSGERITARSCV
LAAGGFESDRDWLREAWGQNERGEWPADNFLIRGTAYNKGVLLKHLLDDHGADRIGDPTQ
AHMVAIDARAPLYDGGICTRIDCVSLGVVVNSEARRFYDEGEDFWPKRYAIWGRLVAQQP
KQIGYSIIDSKAIGRFMPPVFPGVKADTLPDLARQLGLDVDTFMQTLDQYNAACRVGRFD
HTALDDCHTEGVTPAKTHWARPIDTAPFYGYALRPGITFTYLGLRTDDTAAVRFNDQPSP
NLFVAGEMMAGNVLGKGYTAGVGMSIGTAFGRIAGTNAAKAAVKGAQHAGA