Protein Info for GFF2132 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: TcuR: regulates tcuABC genes used in utilization of tricarballylate

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 319 PF00126: HTH_1" amino acids 3 to 61 (59 residues), 76.1 bits, see alignment E=1.6e-25 PF03466: LysR_substrate" amino acids 86 to 298 (213 residues), 115.7 bits, see alignment E=2e-37

Best Hits

KEGG orthology group: K13794, LysR family transcriptional regulator, regulatory protein for tcuABC (inferred from 72% identity to del:DelCs14_5740)

Predicted SEED Role

"TcuR: regulates tcuABC genes used in utilization of tricarballylate" in subsystem Tricarballylate Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (319 amino acids)

>GFF2132 TcuR: regulates tcuABC genes used in utilization of tricarballylate (Hydrogenophaga sp. GW460-11-11-14-LB1)
LELRQLRYFVRVVELGSMGRAAIDLDLVQSALSQQISRLESELSTRLLQRTPRGVVPTDA
GAAFFREAQLTLRHAAQAARAAQAARLSGTVSVGLAPTTAAMLGLPLIQAMQARYPDVRL
HMVESMSGHLAAMLNARELDLAVLFDARLQGQPDGRGGRLWQVLPLLSEDLFLIASRRDP
RPRPATLRLADLGDEPLILPTGPHGLRSTLDAAFARAGVVPRVVLEVDSLSLVMAAVDAG
LGATLQPRAALGAATDAGQRFVLSHIDDPQVNRVNLLCSLSEDELSPAALATRVVVRDTI
QALVQGGQWPGTRLWHHDS