Protein Info for GFF2129 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: bll6904; probable cation efflux system protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 452 transmembrane" amino acids 21 to 40 (20 residues), see Phobius details amino acids 46 to 68 (23 residues), see Phobius details amino acids 103 to 126 (24 residues), see Phobius details amino acids 141 to 163 (23 residues), see Phobius details amino acids 173 to 194 (22 residues), see Phobius details amino acids 200 to 225 (26 residues), see Phobius details amino acids 257 to 280 (24 residues), see Phobius details amino acids 292 to 312 (21 residues), see Phobius details amino acids 324 to 347 (24 residues), see Phobius details amino acids 367 to 387 (21 residues), see Phobius details amino acids 395 to 419 (25 residues), see Phobius details amino acids 425 to 447 (23 residues), see Phobius details TIGR00797: MATE efflux family protein" amino acids 29 to 426 (398 residues), 171.2 bits, see alignment E=1.7e-54 PF01554: MatE" amino acids 33 to 188 (156 residues), 60.6 bits, see alignment E=7.8e-21 amino acids 254 to 413 (160 residues), 66.6 bits, see alignment E=1.1e-22

Best Hits

KEGG orthology group: None (inferred from 42% identity to ddc:Dd586_1398)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (452 amino acids)

>GFF2129 bll6904; probable cation efflux system protein (Hydrogenophaga sp. GW460-11-11-14-LB1)
MSAALAQSRVQQMLHAPLLPTLFRLATPNVMGLFAMTIVIGYDGYILGLVGADALAGIAL
VFPLSMLMLQMSAGGIGGATTAAVARALGAGQREDAGRLAQQALLIAALLAVLFMGAMLG
GGRGIFAAMGGRGPALDAALAYSNALFAGAAVIWFTNVLAAVVRGAGNMLLPSLMLVATA
LLHLGLSPLLVFGWGPVPGIGVAGAALSTLTVNALSAVVMVAWLLRRDGAVHLGRTPWWP
RLALWRDILRVGLPASLSPVISNASIAVATAFVGHYGTAALAGYGVAARLEYILVPIAFG
FGTALTAMVATNMGAGQATRAVRVAWAGGAVVAAITGAIGVATAIAPGLWMNLFTQDAAV
RAFGADYLNIVGGCYGFFGLGLALFFASQGAGRMFWPLAGSMGRLLILVVGGWLCVHVFQ
TSASGLFAVIALSLVVYGSTLAIAIRLGSWTR