Protein Info for GFF2129 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Biotin carboxyl carrier protein of acetyl-CoA carboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00531: acetyl-CoA carboxylase, biotin carboxyl carrier protein
  • amino acids 1 to 156 (156 residues), 236.6 bits, E=8.2e-75
• PF00364: Biotin_lipoyl
  • amino acids 83 to 155 (73 residues), 87.6 bits, E=2e-29

Best Hits

Swiss-Prot: 93% identical to BCCP_ECOL6: Biotin carboxyl carrier protein of acetyl-CoA carboxylase (accB) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K02160, acetyl-CoA carboxylase biotin carboxyl carrier protein (inferred from 99% identity to sew:SeSA_A3571)

MetaCyc: 93% identical to biotin carboxyl carrier protein (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Biotin carboxyl carrier protein of acetyl-CoA carboxylase" in subsystem Fatty Acid Biosynthesis FASII

MetaCyc Pathways

• biotin-carboxyl carrier protein assembly (4/4 steps found)
• 3-hydroxypropanoate cycle (6/13 steps found)
• 3-hydroxypropanoate/4-hydroxybutanate cycle (9/18 steps found)
• glyoxylate assimilation (5/13 steps found)
• superpathway of the 3-hydroxypropanoate cycle (6/18 steps found)

Protein Sequence (156 amino acids)

>GFF2129 Biotin carboxyl carrier protein of acetyl-CoA carboxylase (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MDIRKIKKLIELVEESGISELEISEGEESVRISRTTANAGFPVMQQAYAAPMMQQPALSN
AVAPAATPAMEAPAAAEISGHIVRSPMVGTFYRTPSPDAKAFIEVGQKVNVGDTLCIVEA
MKMMNQIEADKAGTVKAILVESGQPVEFDEPLVVIE