Protein Info for GFF2125 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Ribosomal protein L11 methyltransferase (EC 2.1.1.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 288 PF06325: PrmA" amino acids 1 to 288 (288 residues), 365.9 bits, see alignment E=6.4e-113 TIGR00406: ribosomal protein L11 methyltransferase" amino acids 1 to 281 (281 residues), 409.9 bits, see alignment E=3.1e-127 PF05175: MTS" amino acids 139 to 225 (87 residues), 37.8 bits, see alignment E=5.4e-13 PF13489: Methyltransf_23" amino acids 151 to 225 (75 residues), 30 bits, see alignment E=1.5e-10 PF13847: Methyltransf_31" amino acids 153 to 208 (56 residues), 39.9 bits, see alignment E=1.3e-13 PF13649: Methyltransf_25" amino acids 157 to 223 (67 residues), 33.4 bits, see alignment E=2.2e-11 PF08242: Methyltransf_12" amino acids 158 to 225 (68 residues), 31.2 bits, see alignment E=1.1e-10 PF08241: Methyltransf_11" amino acids 159 to 205 (47 residues), 25.5 bits, see alignment 5.8e-09

Best Hits

Swiss-Prot: 100% identical to PRMA_SALA4: Ribosomal protein L11 methyltransferase (prmA) from Salmonella agona (strain SL483)

KEGG orthology group: K02687, ribosomal protein L11 methyltransferase [EC: 2.1.1.-] (inferred from 99% identity to sed:SeD_A3743)

MetaCyc: 96% identical to ribosomal protein L11 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN0-5419

Predicted SEED Role

"Ribosomal protein L11 methyltransferase (EC 2.1.1.-)" in subsystem Heat shock dnaK gene cluster extended or Ribosome biogenesis bacterial (EC 2.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (288 amino acids)

>GFF2125 Ribosomal protein L11 methyltransferase (EC 2.1.1.-) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
LKLNTTGANAEELSDALMEAGAVSITFQDTHDTPVFEPLPGETRLWGDTDVIGLFDAETD
MKDVVAILEQHPLLGAGFAHKIEQLEDKDWEREWMDNFHPMRFGERLWICPSWRDIPDEN
AVNVMLDPGLAFGTGTHPTTSLCLQWLDGLDLNGKTVIDFGCGSGILAIAALKLGAAKAI
GIDIDPQAIQASRDNAERNGVSDRLELYLPKDQPEAMKADVVVANILAGPLRELAPLISV
LPVEGGLLGLSGILASQAESVCDAYAELFTLDPVVEKEEWCRITGRKK