Protein Info for GFF2124 in Variovorax sp. SCN45

Annotation: Cytochrome oxidase biogenesis protein Sco1/SenC/PrrC, thiol-disulfide reductase involved in Cu(I) insertion into CoxII Cu(A) center

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 205 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF00578: AhpC-TSA" amino acids 47 to 181 (135 residues), 36.2 bits, see alignment E=5.3e-13 PF02630: SCO1-SenC" amino acids 48 to 178 (131 residues), 152.5 bits, see alignment E=6.8e-49

Best Hits

Swiss-Prot: 36% identical to SCO22_RICPR: SCO2-like protein RP587 (RP587) from Rickettsia prowazekii (strain Madrid E)

KEGG orthology group: K07152, (no description) (inferred from 84% identity to vpe:Varpa_5259)

Predicted SEED Role

"Cytochrome oxidase biogenesis protein Sco1/SenC/PrrC, putative copper metallochaperone" in subsystem Biogenesis of cytochrome c oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (205 amino acids)

>GFF2124 Cytochrome oxidase biogenesis protein Sco1/SenC/PrrC, thiol-disulfide reductase involved in Cu(I) insertion into CoxII Cu(A) center (Variovorax sp. SCN45)
MTHSTLSRRGLLLSGGTALAAMALAGCDSKVLPASFNGIDISGAKYAQDFRLTDPDGRER
TLADFKGKAVMMFFGFTQCPDVCPTALVRAAEIRRLLGADGERLQVIFVTVDPERDTPVV
LKAYTQAFDPSFIGLYGDLQKTSDTARDFKVFYKKVPTGSSYTMDHSAFSYVFDPKGKIR
LVLRHEQSAQECAQDLRQILGSASA