Protein Info for GFF2122 in Variovorax sp. SCN45

Annotation: Type IV pilus biogenesis protein PilE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 transmembrane" amino acids 17 to 41 (25 residues), see Phobius details PF07963: N_methyl" amino acids 15 to 38 (24 residues), 35.6 bits, see alignment 4.6e-13 TIGR02532: prepilin-type N-terminal cleavage/methylation domain" amino acids 16 to 38 (23 residues), 34 bits, see alignment 8.6e-13 PF16732: ComP_DUS" amino acids 39 to 131 (93 residues), 85 bits, see alignment E=5.6e-28

Best Hits

KEGG orthology group: K02655, type IV pilus assembly protein PilE (inferred from 58% identity to cti:RALTA_A2324)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (150 amino acids)

>GFF2122 Type IV pilus biogenesis protein PilE (Variovorax sp. SCN45)
MKTLQQRSNTSRRAGAGFTLIEVMIVVAIVAILAAIAYPAYQRQIQKSRRTDAKTALLDL
ATRQERYFTMNNTYVGAADKLGYGGPFPLDVLTSGTAFYQLNVTASSATGFTATATPVNA
QASDTLCGTYTIDQLGTQSSSGTLGAAACW